Lineage for d3vs4a1 (3vs4 A:85-146)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1310020Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1310021Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1310209Protein Hemapoetic cell kinase Hck [50062] (1 species)
  7. 1310210Species Human (Homo sapiens) [TaxId:9606] [50063] (20 PDB entries)
  8. 1310236Domain d3vs4a1: 3vs4 A:85-146 [218082]
    Other proteins in same PDB: d3vs4a2, d3vs4a3, d3vs4b2, d3vs4b3
    automated match to d1qcfa1
    complexed with ca, cl, vsf

Details for d3vs4a1

PDB Entry: 3vs4 (more details), 2.75 Å

PDB Description: Crystal structure of HCK complexed with a pyrrolo-pyrimidine inhibitor 5-(4-phenoxyphenyl)-7-(tetrahydro-2H-pyran-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-4-amine
PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d3vs4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vs4a1 b.34.2.1 (A:85-146) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
riivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsl
et

SCOPe Domain Coordinates for d3vs4a1:

Click to download the PDB-style file with coordinates for d3vs4a1.
(The format of our PDB-style files is described here.)

Timeline for d3vs4a1: