SCOPe 2.04: Domain d3vs2b1: 3vs2 B:85-146

Lineage for d3vs2b1 (3vs2 B:85-146)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Hemapoetic cell kinase Hck [50062] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50063] (20 PDB entries)

8. Domain d3vs2b1: 3vs2 B:85-146 [218073]
   Other proteins in same PDB: d3vs2a2, d3vs2a3, d3vs2b2, d3vs2b3
   automated match to d1qcfa1
   complexed with ca, cl, vsb

Details for d3vs2b1

PDB Entry: 3vs2, 2.61 Å

PDB Description: Crystal structure of HCK complexed with a pyrrolo-pyrimidine inhibitor 7-[cis-4-(4-methylpiperazin-1-yl)cyclohexyl]-5-(4-phenoxyphenyl)-7H-pyrrolo[2,3-d]pyrimidin-4-amine

PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d3vs2b1:

Sequence; same for both SEQRES and ATOM records:

>d3vs2b1 b.34.2.1 (B:85-146) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
riivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsl
et

Timeline for d3vs2b1:

• d3vs2b1 first appeared in SCOPe 2.03
  
• d3vs2b1 appears in SCOPe 2.05
  
• d3vs2b1 appears in the current release, SCOPe 2.08