Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Galactose oxidase, C-terminal domain [49209] (3 species) follows the catalytic seven-bladed beta-propeller domain |
Species Dactylium dendroides [TaxId:5132] [49210] (3 PDB entries) Uniprot Q01745 42-680 |
Domain d1gofa1: 1gof A:538-639 [21807] Other proteins in same PDB: d1gofa2, d1gofa3 complexed with acy, cu, na |
PDB Entry: 1gof (more details), 1.7 Å
SCOPe Domain Sequences for d1gofa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gofa1 b.1.18.2 (A:538-639) Galactose oxidase, C-terminal domain {Dactylium dendroides [TaxId: 5132]} gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq
Timeline for d1gofa1: