SCOPe 2.05: Domain d3vrzb1: 3vrz B:85-146

Lineage for d3vrzb1 (3vrz B:85-146)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Hemapoetic cell kinase Hck [50062] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50063] (20 PDB entries)

8. Domain d3vrzb1: 3vrz B:85-146 [218055]
   Other proteins in same PDB: d3vrza2, d3vrza3, d3vrzb2, d3vrzb3
   automated match to d1qcfa1
   complexed with ca, cl, vrz

Details for d3vrzb1

PDB Entry: 3vrz, 2.22 Å

PDB Description: Crystal structure of HCK complexed with a pyrrolo-pyrimidine inhibitor 1-[4-(4-amino-7-cyclopentyl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)phenyl]-3-benzylurea

PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d3vrzb1:

Sequence; same for both SEQRES and ATOM records:

>d3vrzb1 b.34.2.1 (B:85-146) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
riivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsl
et

Timeline for d3vrzb1:

• d3vrzb1 first appeared in SCOPe 2.03
  
• d3vrzb1 appears in SCOPe 2.04
  
• d3vrzb1 appears in SCOPe 2.06
  
• d3vrzb1 appears in the current release, SCOPe 2.08