Lineage for d3vryb2 (3vry B:147-249)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1918723Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1918955Protein Hemopoetic cell kinase Hck [55565] (1 species)
  7. 1918956Species Human (Homo sapiens) [TaxId:9606] [55566] (18 PDB entries)
  8. 1918970Domain d3vryb2: 3vry B:147-249 [218050]
    Other proteins in same PDB: d3vrya1, d3vrya3, d3vryb1, d3vryb3
    automated match to d1qcfa2
    complexed with b43, ca, cl

Details for d3vryb2

PDB Entry: 3vry (more details), 2.48 Å

PDB Description: Crystal structure of HCK complexed with a pyrrolo-pyrimidine inhibitor 4-Amino-5-(4-phenoxyphenyl)-7H-pyrrolo[2,3-d]pyrimidin-7-yl-cyclopentane
PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d3vryb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vryb2 d.93.1.1 (B:147-249) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

SCOPe Domain Coordinates for d3vryb2:

Click to download the PDB-style file with coordinates for d3vryb2.
(The format of our PDB-style files is described here.)

Timeline for d3vryb2: