SCOP 1.67: Domain d2dl2a1: 2dl2 A:4-101

Lineage for d2dl2a1 (2dl2 A:4-101)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (32 proteins)

6. Protein Killer cell inhibitory receptor [49202] (4 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens), 2dl2 [TaxId:9606] [49205] (2 PDB entries)

8. Domain d2dl2a1: 2dl2 A:4-101 [21803]

Details for d2dl2a1

PDB Entry: 2dl2, 3 Å

PDB Description: killer immunoglobulin receptor 2dl2

SCOP Domain Sequences for d2dl2a1:

Sequence; same for both SEQRES and ATOM records:

>d2dl2a1 b.1.1.4 (A:4-101) Killer cell inhibitory receptor {Human (Homo sapiens), 2dl2}
ahrkpsllahpgrlvkseetvilqcwsdvrfehfllhregkfkdtlhligehhdgvskan
fsigpmmqdlagtyrcygsvthspyqlsapsdpldivi

Timeline for d2dl2a1:

• d2dl2a1 first appeared (with stable ids) in SCOP 1.55
  
• d2dl2a1 appears in SCOP 1.65
  
• d2dl2a1 appears in SCOP 1.69
  
• d2dl2a1 appears in the current release, SCOPe 2.08