Lineage for d2dl2a1 (2dl2 A:4-101)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9408Family b.1.1.4: I set domains [49159] (21 proteins)
  6. 9477Protein Killer cell inhibitory receptor [49202] (3 species)
  7. 9478Species Human (Homo sapiens), 2dl2 [TaxId:9606] [49205] (2 PDB entries)
  8. 9481Domain d2dl2a1: 2dl2 A:4-101 [21803]

Details for d2dl2a1

PDB Entry: 2dl2 (more details), 3 Å

PDB Description: killer immunoglobulin receptor 2dl2
PDB Compounds: (A:)

SCOP Domain Sequences for d2dl2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dl2a1 b.1.1.4 (A:4-101) Killer cell inhibitory receptor {Human (Homo sapiens), 2dl2}
ahrkpsllahpgrlvkseetvilqcwsdvrfehfllhregkfkdtlhligehhdgvskan
fsigpmmqdlagtyrcygsvthspyqlsapsdpldivi

SCOP Domain Coordinates for d2dl2a1:

Click to download the PDB-style file with coordinates for d2dl2a1.
(The format of our PDB-style files is described here.)

Timeline for d2dl2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dl2a2