Lineage for d2dlia1 (2dli A:5-101)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 656838Family b.1.1.4: I set domains [49159] (36 proteins)
  6. 657051Protein Killer cell inhibitory receptor [49202] (4 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 657052Species Human (Homo sapiens), 2dl2 [TaxId:9606] [49205] (2 PDB entries)
  8. 657053Domain d2dlia1: 2dli A:5-101 [21801]

Details for d2dlia1

PDB Entry: 2dli (more details), 2.9 Å

PDB Description: killer immunoglobulin receptor 2dl2,trigonal form
PDB Compounds: (A:) protein (MHC class I nk cell receptor precursor)

SCOP Domain Sequences for d2dlia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dlia1 b.1.1.4 (A:5-101) Killer cell inhibitory receptor {Human (Homo sapiens), 2dl2 [TaxId: 9606]}
hrkpsllahpgrlvkseetvilqcwsdvrfehfllhregkfkdtlhligehhdgvskanf
sigpmmqdlagtyrcygsvthspyqlsapsdpldivi

SCOP Domain Coordinates for d2dlia1:

Click to download the PDB-style file with coordinates for d2dlia1.
(The format of our PDB-style files is described here.)

Timeline for d2dlia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dlia2