Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein Lactate dehydrogenase [56339] (18 species) |
Species Thermus caldophilus [TaxId:272] [226615] (2 PDB entries) |
Domain d3vphc2: 3vph C:163-330 [218008] Other proteins in same PDB: d3vpha1, d3vphb1, d3vphc1, d3vphd1 automated match to d1llda2 complexed with fbp, gol, nad, oxm |
PDB Entry: 3vph (more details), 2 Å
SCOPe Domain Sequences for d3vphc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vphc2 d.162.1.1 (C:163-330) Lactate dehydrogenase {Thermus caldophilus [TaxId: 272]} tildtarfrallaehlrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargral spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpeveg vlevslslprilgaggvegtvypslspeerealrrsaeilkeaafalgf
Timeline for d3vphc2: