Lineage for d3vphb1 (3vph B:21-162)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844354Protein Lactate dehydrogenase [51859] (19 species)
  7. 2844723Species Thermus caldophilus [TaxId:272] [226614] (2 PDB entries)
  8. 2844729Domain d3vphb1: 3vph B:21-162 [218005]
    Other proteins in same PDB: d3vpha2, d3vphb2, d3vphc2, d3vphd2
    automated match to d1llda1
    complexed with fbp, gol, nad, oxm

Details for d3vphb1

PDB Entry: 3vph (more details), 2 Å

PDB Description: l-lactate dehydrogenase from thermus caldophilus gk24 complexed with oxamate, nadh and fbp
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3vphb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vphb1 c.2.1.5 (B:21-162) Lactate dehydrogenase {Thermus caldophilus [TaxId: 272]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayrlsalppgrvvgsg

SCOPe Domain Coordinates for d3vphb1:

Click to download the PDB-style file with coordinates for d3vphb1.
(The format of our PDB-style files is described here.)

Timeline for d3vphb1: