SCOPe 2.03: Domain d3vpha2: 3vph A:163-330

Lineage for d3vpha2 (3vph A:163-330)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Lactate dehydrogenase [56339] (18 species)

7. Species Thermus caldophilus [TaxId:272] [226615] (2 PDB entries)

8. Domain d3vpha2: 3vph A:163-330 [218004]
   Other proteins in same PDB: d3vpha1, d3vphb1, d3vphc1, d3vphd1
   automated match to d1llda2
   complexed with fbp, gol, nad, oxm

Details for d3vpha2

PDB Entry: 3vph, 2 Å

PDB Description: l-lactate dehydrogenase from thermus caldophilus gk24 complexed with oxamate, nadh and fbp

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3vpha2:

Sequence; same for both SEQRES and ATOM records:

>d3vpha2 d.162.1.1 (A:163-330) Lactate dehydrogenase {Thermus caldophilus [TaxId: 272]}
tildtarfrallaehlrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargral
spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpeveg
vlevslslprilgaggvegtvypslspeerealrrsaeilkeaafalgf

Timeline for d3vpha2:

• d3vpha2 is new in SCOPe 2.03-stable
  
• d3vpha2 appears in SCOPe 2.04
  
• d3vpha2 appears in the current release, SCOPe 2.08