Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein Lactate dehydrogenase [56339] (19 species) |
Species Thermus caldophilus [TaxId:272] [226615] (2 PDB entries) |
Domain d3vpgd2: 3vpg D:163-330 [218002] Other proteins in same PDB: d3vpga1, d3vpgb1, d3vpgc1, d3vpgd1 automated match to d1llda2 complexed with gol |
PDB Entry: 3vpg (more details), 1.8 Å
SCOPe Domain Sequences for d3vpgd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vpgd2 d.162.1.1 (D:163-330) Lactate dehydrogenase {Thermus caldophilus [TaxId: 272]} tildtarfrallaehlrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargral spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpeveg vlevslslprilgaggvegtvypslspeerealrrsaeilkeaafalgf
Timeline for d3vpgd2: