SCOP 1.71: Domain d1nkr_2: 1nkr 102-200

Lineage for d1nkr_2 (1nkr 102-200)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (34 proteins)

6. Protein Killer cell inhibitory receptor [49202] (4 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens), p58-cl42 kir [TaxId:9606] [49204] (2 PDB entries)

8. Domain d1nkr_2: 1nkr 102-200 [21800]

Details for d1nkr_2

PDB Entry: 1nkr, 1.7 Å

PDB Description: inhibitory receptor (p58-cl42) for human natural killer cells

SCOP Domain Sequences for d1nkr_2:

Sequence; same for both SEQRES and ATOM records:

>d1nkr_2 b.1.1.4 (102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir}
iglyekpslsaqpgptvlagenvtlscssrssydmyhlsregeaherrlpagpkvngtfq
adfplgpathggtyrcfgsfhdspyewskssdpllvsvt

Timeline for d1nkr_2:

• d1nkr_2 first appeared (with stable ids) in SCOP 1.55
  
• d1nkr_2 appears in SCOP 1.69
  
• d1nkr_2 is called d1nkra2 in SCOP 1.73
  
• d1nkr_2 appears in the current release, SCOPe 2.08, called d1nkra2