Lineage for d1nkr_2 (1nkr 102-200)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 454655Family b.1.1.4: I set domains [49159] (32 proteins)
  6. 454840Protein Killer cell inhibitory receptor [49202] (4 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 454856Species Human (Homo sapiens), p58-cl42 kir [TaxId:9606] [49204] (2 PDB entries)
  8. 454858Domain d1nkr_2: 1nkr 102-200 [21800]

Details for d1nkr_2

PDB Entry: 1nkr (more details), 1.7 Å

PDB Description: inhibitory receptor (p58-cl42) for human natural killer cells
PDB Compounds: ( :)

SCOP Domain Sequences for d1nkr_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkr_2 b.1.1.4 (102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir}
iglyekpslsaqpgptvlagenvtlscssrssydmyhlsregeaherrlpagpkvngtfq
adfplgpathggtyrcfgsfhdspyewskssdpllvsvt

SCOP Domain Coordinates for d1nkr_2:

Click to download the PDB-style file with coordinates for d1nkr_2.
(The format of our PDB-style files is described here.)

Timeline for d1nkr_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nkr_1