Lineage for d1nkr_2 (1nkr 102-200)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (21 proteins) 
Protein Killer cell inhibitory receptor [49202] (3 species) Species Human (Homo sapiens), p58-cl42 kir [TaxId:9606] [49204] (1 PDB entry) 
Domain d1nkr_2: 1nkr 102-200 [21800]
Details for d1nkr_2
PDB Entry: 1nkr (more details), 1.7 Å
PDB Description: inhibitory receptor (p58-cl42) for human natural killer cells
SCOP Domain Sequences for d1nkr_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nkr_2 b.1.1.4 (102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir}
iglyekpslsaqpgptvlagenvtlscssrssydmyhlsregeaherrlpagpkvngtfq
adfplgpathggtyrcfgsfhdspyewskssdpllvsvt
SCOP Domain Coordinates for d1nkr_2:
Click to download the PDB-style file with coordinates for d1nkr_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nkr_2:
- d1nkr_2 appears in SCOP 1.57
- d1nkr_2 appears in the current release, SCOPe 2.08, called d1nkra2
View in 3D
