Lineage for d1nkra2 (1nkr A:102-200)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753801Protein Killer cell inhibitory receptor [49202] (4 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2753817Species Human (Homo sapiens), p58-cl42 kir [TaxId:9606] [49204] (2 PDB entries)
  8. 2753819Domain d1nkra2: 1nkr A:102-200 [21800]

Details for d1nkra2

PDB Entry: 1nkr (more details), 1.7 Å

PDB Description: inhibitory receptor (p58-cl42) for human natural killer cells
PDB Compounds: (A:) p58-cl42 kir

SCOPe Domain Sequences for d1nkra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]}
iglyekpslsaqpgptvlagenvtlscssrssydmyhlsregeaherrlpagpkvngtfq
adfplgpathggtyrcfgsfhdspyewskssdpllvsvt

SCOPe Domain Coordinates for d1nkra2:

Click to download the PDB-style file with coordinates for d1nkra2.
(The format of our PDB-style files is described here.)

Timeline for d1nkra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nkra1