SCOP 1.73: Domain d1nkra1: 1nkr A:6-101

Lineage for d1nkra1 (1nkr A:6-101)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (36 proteins)

6. Protein Killer cell inhibitory receptor [49202] (4 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens), p58-cl42 kir [TaxId:9606] [49204] (2 PDB entries)

8. Domain d1nkra1: 1nkr A:6-101 [21799]

Details for d1nkra1

PDB Entry: 1nkr, 1.7 Å

PDB Description: inhibitory receptor (p58-cl42) for human natural killer cells

PDB Compounds: (A:) p58-cl42 kir

SCOP Domain Sequences for d1nkra1:

Sequence; same for both SEQRES and ATOM records:

>d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]}
rkpsllahpgplvkseetvilqcwsdvmfehfllhregmfndtlrligehhdgvskanfs
isrmtqdlagtyrcygsvthspyqvsapsdpldivi

Timeline for d1nkra1:

• d1nkra1 first appeared (with stable ids) in SCOP 1.55, called d1nkr_1
  
• d1nkra1 was called d1nkr_1 in SCOP 1.71
  
• d1nkra1 appears in SCOP 1.75
  
• d1nkra1 appears in the current release, SCOPe 2.08