Lineage for d1nkr_1 (1nkr 6-101)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104725Family b.1.1.4: I set domains [49159] (25 proteins)
  6. 104848Protein Killer cell inhibitory receptor [49202] (3 species)
  7. 104861Species Human (Homo sapiens), p58-cl42 kir [TaxId:9606] [49204] (2 PDB entries)
  8. 104862Domain d1nkr_1: 1nkr 6-101 [21799]

Details for d1nkr_1

PDB Entry: 1nkr (more details), 1.7 Å

PDB Description: inhibitory receptor (p58-cl42) for human natural killer cells

SCOP Domain Sequences for d1nkr_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkr_1 b.1.1.4 (6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir}
rkpsllahpgplvkseetvilqcwsdvmfehfllhregmfndtlrligehhdgvskanfs
isrmtqdlagtyrcygsvthspyqvsapsdpldivi

SCOP Domain Coordinates for d1nkr_1:

Click to download the PDB-style file with coordinates for d1nkr_1.
(The format of our PDB-style files is described here.)

Timeline for d1nkr_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nkr_2