SCOPe 2.03: Domain d3vpfb1: 3vpf B:4-150

Lineage for d3vpfb1 (3vpf B:4-150)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (17 species)

7. Species Lactobacillus casei [TaxId:1582] [51865] (6 PDB entries)

8. Domain d3vpfb1: 3vpf B:4-150 [217985]
   Other proteins in same PDB: d3vpfa2, d3vpfb2, d3vpfc2, d3vpfd2, d3vpfe2, d3vpff2
   automated match to d1llca1
   complexed with pyr, so4; mutant

Details for d3vpfb1

PDB Entry: 3vpf, 2.79 Å

PDB Description: complex structure of lactobacillus casei lactate dehydrogenase penta mutant with pyruvate

PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3vpfb1:

Sequence; same for both SEQRES and ATOM records:

>d3vpfb1 c.2.1.5 (B:4-150) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
itdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpftsp
kkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflv
aanpvdiltyatwklsgfpknrvvgsg

Timeline for d3vpfb1:

• d3vpfb1 is new in SCOPe 2.03-stable
  
• d3vpfb1 appears in SCOPe 2.04
  
• d3vpfb1 last appears in SCOPe 2.07