Lineage for d3vpdb2 (3vpd B:89-281)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432977Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1432978Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1433252Family d.142.1.7: Lysine biosynthesis enzyme LysX ATP-binding domain [103281] (2 proteins)
    automatically mapped to Pfam PF08443
    automatically mapped to Pfam PF13535
  6. 1433259Protein automated matches [227109] (1 species)
    not a true protein
  7. 1433260Species Thermus thermophilus [TaxId:274] [226604] (1 PDB entry)
  8. 1433262Domain d3vpdb2: 3vpd B:89-281 [217982]
    Other proteins in same PDB: d3vpda1, d3vpdb1
    automated match to d1uc8a2
    complexed with anp, bua, cit

Details for d3vpdb2

PDB Entry: 3vpd (more details), 1.95 Å

PDB Description: LysX from Thermus thermophilus complexed with AMP-PNP
PDB Compounds: (B:) Ribosomal protein S6 modification protein

SCOPe Domain Sequences for d3vpdb2:

Sequence, based on SEQRES records: (download)

>d3vpdb2 d.142.1.7 (B:89-281) automated matches {Thermus thermophilus [TaxId: 274]}
kwatsvalakaglpqpktalatdreealrlmeafgypvvlkpvigswgrllakvtdraaa
eallehkevlggfqhqlfyiqeyvekpgrdirvfvvgeraiaaiyrrsahwitntarggq
aencplteeiarlsvgaaeavgggvvavdlfesergllvnevnhtmefknsvhttgvdip
geilryawevarg

Sequence, based on observed residues (ATOM records): (download)

>d3vpdb2 d.142.1.7 (B:89-281) automated matches {Thermus thermophilus [TaxId: 274]}
kwatsvalakaglpqpktalatdreealrlmeafgypvvlkpvigswgrllakvtdraaa
eallehkevlggfqhqlfyiqeyvekpgrdirvfvvgeraiaaiyrqaencplteeiarl
svgaaeavgggvvavdlfesergllvnevnhtmefknsvhttgvdipgeilryawevarg

SCOPe Domain Coordinates for d3vpdb2:

Click to download the PDB-style file with coordinates for d3vpdb2.
(The format of our PDB-style files is described here.)

Timeline for d3vpdb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vpdb1