SCOP 1.71: Domain d1b6u_2: 1b6u 104-203

Lineage for d1b6u_2 (1b6u 104-203)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (34 proteins)

6. Protein Killer cell inhibitory receptor [49202] (4 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens), kir2dl3 [TaxId:9606] [49203] (2 PDB entries)

8. Domain d1b6u_2: 1b6u 104-203 [21798]

Details for d1b6u_2

PDB Entry: 1b6u, 3 Å

PDB Description: crystal structure of the human killer cell inhibitory receptor (kir2dl3) specific for hla-cw3 related alleles

SCOP Domain Sequences for d1b6u_2:

Sequence; same for both SEQRES and ATOM records:

>d1b6u_2 b.1.1.4 (104-203) Killer cell inhibitory receptor {Human (Homo sapiens), kir2dl3}
lyekpslsaqpgptvlagesvtlscssrssydmyhlsregeaherrfsagpkvngtfqad
fplgpathggtyrcfgsfrdspyewsnssdpllvsvtgnp

Timeline for d1b6u_2:

• d1b6u_2 first appeared (with stable ids) in SCOP 1.55
  
• d1b6u_2 appears in SCOP 1.69
  
• d1b6u_2 is called d1b6ua2 in SCOP 1.73
  
• d1b6u_2 appears in the current release, SCOPe 2.08, called d1b6ua2