Lineage for d1b6u_2 (1b6u 104-203)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 454655Family b.1.1.4: I set domains [49159] (32 proteins)
  6. 454840Protein Killer cell inhibitory receptor [49202] (4 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 454846Species Human (Homo sapiens), kir2dl3 [TaxId:9606] [49203] (2 PDB entries)
  8. 454852Domain d1b6u_2: 1b6u 104-203 [21798]

Details for d1b6u_2

PDB Entry: 1b6u (more details), 3 Å

PDB Description: crystal structure of the human killer cell inhibitory receptor (kir2dl3) specific for hla-cw3 related alleles
PDB Compounds: ( :)

SCOP Domain Sequences for d1b6u_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6u_2 b.1.1.4 (104-203) Killer cell inhibitory receptor {Human (Homo sapiens), kir2dl3}
lyekpslsaqpgptvlagesvtlscssrssydmyhlsregeaherrfsagpkvngtfqad
fplgpathggtyrcfgsfrdspyewsnssdpllvsvtgnp

SCOP Domain Coordinates for d1b6u_2:

Click to download the PDB-style file with coordinates for d1b6u_2.
(The format of our PDB-style files is described here.)

Timeline for d1b6u_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b6u_1