SCOP 1.59: Domain d1b6u_1: 1b6u 5-103

Lineage for d1b6u_1 (1b6u 5-103)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.4: I set domains [49159] (25 proteins)

6. Protein Killer cell inhibitory receptor [49202] (3 species)

7. Species Human (Homo sapiens), kir2dl3 [TaxId:9606] [49203] (2 PDB entries)

8. Domain d1b6u_1: 1b6u 5-103 [21797]

Details for d1b6u_1

PDB Entry: 1b6u, 3 Å

PDB Description: crystal structure of the human killer cell inhibitory receptor (kir2dl3) specific for hla-cw3 related alleles

SCOP Domain Sequences for d1b6u_1:

Sequence; same for both SEQRES and ATOM records:

>d1b6u_1 b.1.1.4 (5-103) Killer cell inhibitory receptor {Human (Homo sapiens), kir2dl3}
hrkpsllahpgplvkseetvilqcwsdvrfqhfllhregkfkdtlhligehhdgvskanf
sigpmmqdlagtyrcygsvthspyqlsapsdpldivitg

Timeline for d1b6u_1:

• d1b6u_1 first appeared (with stable ids) in SCOP 1.55
  
• d1b6u_1 appears in SCOP 1.57
  
• d1b6u_1 appears in SCOP 1.61
  
• d1b6u_1 appears in the current release, SCOPe 2.08, called d1b6ua1