Lineage for d1efxe2 (1efx E:104-200)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 935313Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 935541Protein Killer cell inhibitory receptor [49202] (4 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 935547Species Human (Homo sapiens), kir2dl3 [TaxId:9606] [49203] (2 PDB entries)
  8. 935551Domain d1efxe2: 1efx E:104-200 [21796]
    Other proteins in same PDB: d1efxa1, d1efxa2, d1efxb_

Details for d1efxe2

PDB Entry: 1efx (more details), 3 Å

PDB Description: structure of a complex between the human natural killer cell receptor kir2dl2 and a class i mhc ligand hla-cw3
PDB Compounds: (E:) natural killer cell receptor kir2dl2

SCOPe Domain Sequences for d1efxe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efxe2 b.1.1.4 (E:104-200) Killer cell inhibitory receptor {Human (Homo sapiens), kir2dl3 [TaxId: 9606]}
lyekpslsaqpgptvlagesvtlscssrssydmyhlsregeahecrfsagpkvngtfqad
fplgpathggtyrcfgsfrdspyewsnssdpllvsvi

SCOPe Domain Coordinates for d1efxe2:

Click to download the PDB-style file with coordinates for d1efxe2.
(The format of our PDB-style files is described here.)

Timeline for d1efxe2: