SCOP 1.59: Domain d1efxe2: 1efx E:104-200

Lineage for d1efxe2 (1efx E:104-200)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.4: I set domains [49159] (25 proteins)

6. Protein Killer cell inhibitory receptor [49202] (3 species)

7. Species Human (Homo sapiens), kir2dl3 [TaxId:9606] [49203] (2 PDB entries)

8. Domain d1efxe2: 1efx E:104-200 [21796]
   Other proteins in same PDB: d1efxa1, d1efxa2, d1efxb1

Details for d1efxe2

PDB Entry: 1efx, 3 Å

PDB Description: structure of a complex between the human natural killer cell receptor kir2dl2 and a class i mhc ligand hla-cw3

SCOP Domain Sequences for d1efxe2:

Sequence; same for both SEQRES and ATOM records:

>d1efxe2 b.1.1.4 (E:104-200) Killer cell inhibitory receptor {Human (Homo sapiens), kir2dl3}
lyekpslsaqpgptvlagesvtlscssrssydmyhlsregeahecrfsagpkvngtfqad
fplgpathggtyrcfgsfrdspyewsnssdpllvsvi

Timeline for d1efxe2:

• d1efxe2 first appeared (with stable ids) in SCOP 1.55
  
• d1efxe2 appears in SCOP 1.57
  
• d1efxe2 appears in SCOP 1.61
  
• d1efxe2 appears in the current release, SCOPe 2.08