![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein Killer cell inhibitory receptor [49202] (4 species) possibly an intermediate structure between the I set and FnIII domains |
![]() | Species Human (Homo sapiens), kir2dl3 [TaxId:9606] [49203] (2 PDB entries) |
![]() | Domain d1efxe1: 1efx E:4-103 [21795] Other proteins in same PDB: d1efxa1, d1efxa2, d1efxb_ |
PDB Entry: 1efx (more details), 3 Å
SCOPe Domain Sequences for d1efxe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efxe1 b.1.1.4 (E:4-103) Killer cell inhibitory receptor {Human (Homo sapiens), kir2dl3 [TaxId: 9606]} vhrkpsllahpgrlvkseetvilqcwsdvrfehfllhregkfkdtlhligehhdgvskan fsigpmmqdlagtyrcygsvthspyqlsapsdpldivitg
Timeline for d1efxe1: