Lineage for d3vm7a2 (3vm7 A:401-491)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804045Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1804046Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1804620Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 1804621Protein automated matches [226835] (30 species)
    not a true protein
  7. 1804701Species Malbranchea cinnamomea [TaxId:5041] [226683] (1 PDB entry)
  8. 1804702Domain d3vm7a2: 3vm7 A:401-491 [217941]
    Other proteins in same PDB: d3vm7a1
    automated match to d2taaa1
    complexed with ca, glc, nag, trs

Details for d3vm7a2

PDB Entry: 3vm7 (more details), 2.25 Å

PDB Description: structure of an alpha-amylase from malbranchea cinnamomea
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d3vm7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vm7a2 b.71.1.0 (A:401-491) automated matches {Malbranchea cinnamomea [TaxId: 5041]}
tptdikysddhtlalvkgavttvltnaganagettvtveatgyasgeqvtdvlscesiaa
sdggrlsvtlnqglprvffptdalagsglce

SCOPe Domain Coordinates for d3vm7a2:

Click to download the PDB-style file with coordinates for d3vm7a2.
(The format of our PDB-style files is described here.)

Timeline for d3vm7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vm7a1