Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (30 species) not a true protein |
Species Malbranchea cinnamomea [TaxId:5041] [226683] (1 PDB entry) |
Domain d3vm7a2: 3vm7 A:401-491 [217941] Other proteins in same PDB: d3vm7a1 automated match to d2taaa1 complexed with ca, glc, nag, trs |
PDB Entry: 3vm7 (more details), 2.25 Å
SCOPe Domain Sequences for d3vm7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vm7a2 b.71.1.0 (A:401-491) automated matches {Malbranchea cinnamomea [TaxId: 5041]} tptdikysddhtlalvkgavttvltnaganagettvtveatgyasgeqvtdvlscesiaa sdggrlsvtlnqglprvffptdalagsglce
Timeline for d3vm7a2: