SCOPe 2.01: Domain d1efxd2: 1efx D:104-200

Lineage for d1efxd2 (1efx D:104-200)

Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.4: I set domains [49159] (39 proteins)
Protein Killer cell inhibitory receptor [49202] (4 species)
possibly an intermediate structure between the I set and FnIII domains
Species Human (Homo sapiens), kir2dl3 [TaxId:9606] [49203] (2 PDB entries)
Domain d1efxd2: 1efx D:104-200 [21794]
Other proteins in same PDB: d1efxa1, d1efxa2, d1efxb_

Details for d1efxd2

PDB Description: structure of a complex between the human natural killer cell receptor kir2dl2 and a class i mhc ligand hla-cw3

PDB Compounds: (D:) natural killer cell receptor kir2dl2

SCOPe Domain Sequences for d1efxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efxd2 b.1.1.4 (D:104-200) Killer cell inhibitory receptor {Human (Homo sapiens), kir2dl3 [TaxId: 9606]}
lyekpslsaqpgptvlagesvtlscssrssydmyhlsregeahecrfsagpkvngtfqad
fplgpathggtyrcfgsfrdspyewsnssdpllvsvi

SCOPe Domain Coordinates for d1efxd2:

Click to download the PDB-style file with coordinates for d1efxd2.
(The format of our PDB-style files is described here.)

Timeline for d1efxd2: