Lineage for d3vm5a1 (3vm5 A:1-404)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093019Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2093517Protein automated matches [190099] (25 species)
    not a true protein
  7. 2093626Species Oryzias latipes [TaxId:8090] [226401] (1 PDB entry)
  8. 2093627Domain d3vm5a1: 3vm5 A:1-404 [217938]
    Other proteins in same PDB: d3vm5a2, d3vm5a3
    automated match to d1smda2
    complexed with ca, cl

Details for d3vm5a1

PDB Entry: 3vm5 (more details), 2.85 Å

PDB Description: Recombinant medaka fish alpha-amylase expressed in yeast Pichia pastoris
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d3vm5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vm5a1 c.1.8.1 (A:1-404) automated matches {Oryzias latipes [TaxId: 8090]}
qhnpntrdgrtaivhlfewrwadiaaecerflgpkgfagvqisppnehilvsspwrpwwq
ryqpisynlcsrsggenelrdmitrcnnvgvnvyvdavinhmcgagggegthsscgswfn
annkdfpsvpysnldfndgkcktgsgnienygdpyqvrdcrlvglldlalekdyvrgkva
dfmnklidmgvagfrvdackhmwpgdldnvyrrlnnlntkwfpggsrpfifqevidlgge
pittgeyvglgrvtefkygarlgelfrkwngqklsytknwgegwgfmadgnavvftdnhd
nqrghgaggasiltfwdprlykmavgymlahpygftrvmssyswdrnfvngkdendwigp
psngdgstkpvpinpdqtcgdgwvcehrwrqimnmvqfrnvvng

SCOPe Domain Coordinates for d3vm5a1:

Click to download the PDB-style file with coordinates for d3vm5a1.
(The format of our PDB-style files is described here.)

Timeline for d3vm5a1: