Lineage for d1efxd1 (1efx D:4-103)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 290223Family b.1.1.4: I set domains [49159] (29 proteins)
  6. 290373Protein Killer cell inhibitory receptor [49202] (4 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 290379Species Human (Homo sapiens), kir2dl3 [TaxId:9606] [49203] (2 PDB entries)
  8. 290380Domain d1efxd1: 1efx D:4-103 [21793]
    Other proteins in same PDB: d1efxa1, d1efxa2, d1efxb_

Details for d1efxd1

PDB Entry: 1efx (more details), 3 Å

PDB Description: structure of a complex between the human natural killer cell receptor kir2dl2 and a class i mhc ligand hla-cw3

SCOP Domain Sequences for d1efxd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efxd1 b.1.1.4 (D:4-103) Killer cell inhibitory receptor {Human (Homo sapiens), kir2dl3}
vhrkpsllahpgrlvkseetvilqcwsdvrfehfllhregkfkdtlhligehhdgvskan
fsigpmmqdlagtyrcygsvthspyqlsapsdpldivitg

SCOP Domain Coordinates for d1efxd1:

Click to download the PDB-style file with coordinates for d1efxd1.
(The format of our PDB-style files is described here.)

Timeline for d1efxd1: