Lineage for d1efxd1 (1efx D:4-103)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753801Protein Killer cell inhibitory receptor [49202] (4 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2753807Species Human (Homo sapiens), kir2dl3 [TaxId:9606] [49203] (2 PDB entries)
  8. 2753808Domain d1efxd1: 1efx D:4-103 [21793]
    Other proteins in same PDB: d1efxa1, d1efxa2, d1efxb2, d1efxb3

Details for d1efxd1

PDB Entry: 1efx (more details), 3 Å

PDB Description: structure of a complex between the human natural killer cell receptor kir2dl2 and a class i mhc ligand hla-cw3
PDB Compounds: (D:) natural killer cell receptor kir2dl2

SCOPe Domain Sequences for d1efxd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efxd1 b.1.1.4 (D:4-103) Killer cell inhibitory receptor {Human (Homo sapiens), kir2dl3 [TaxId: 9606]}
vhrkpsllahpgrlvkseetvilqcwsdvrfehfllhregkfkdtlhligehhdgvskan
fsigpmmqdlagtyrcygsvthspyqlsapsdpldivitg

SCOPe Domain Coordinates for d1efxd1:

Click to download the PDB-style file with coordinates for d1efxd1.
(The format of our PDB-style files is described here.)

Timeline for d1efxd1: