SCOPe 2.06: Domain d3vljb2: 3vlj B:424-731

Lineage for d3vljb2 (3vlj B:424-731)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (11 species)
   not a true protein

7. Species Haloarcula marismortui [TaxId:272569] [226809] (7 PDB entries)

8. Domain d3vljb2: 3vlj B:424-731 [217925]
   automated match to d1ub2a2
   complexed with cyn, ddj, hem

Details for d3vljb2

PDB Entry: 3vlj, 1.7 Å

PDB Description: crystal structure analysis of the cyanide arg409leu variant complexes with o-dianisidine in katg from haloarcula marismortui

PDB Compounds: (B:) Catalase-peroxidase 2

SCOPe Domain Sequences for d3vljb2:

Sequence; same for both SEQRES and ATOM records:

>d3vljb2 a.93.1.0 (B:424-731) automated matches {Haloarcula marismortui [TaxId: 272569]}
deemiwqdplpdadydligdeeiaelkeeildsdlsvsqlvktawasastyrdsdkrgga
ngarlrlepqknwevnepeqletvlgtleniqtefndsrsdgtqvsladlivlggnaave
qaaanagydveipfepgrvdagpehtdapsfdalkpkvdgvrnyiqdditrpaeevlvdn
adllnltaseltaliggmrsiganyqdtdlgvftdepetltndffvnlldmgtewepaad
sehrykgldrdtgevkweatridlifgsndrlraisevygsadaekklvhdfvdtwskvm
kldrfdle

Timeline for d3vljb2:

• d3vljb2 first appeared in SCOPe 2.03
  
• d3vljb2 appears in SCOPe 2.05
  
• d3vljb2 appears in SCOPe 2.07
  
• d3vljb2 appears in the current release, SCOPe 2.08