Lineage for d3vlib1 (3vli B:18-423)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1275305Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1275306Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1275879Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 1275880Protein automated matches [191104] (8 species)
    not a true protein
  7. 1275881Species Haloarcula marismortui [TaxId:272569] [226809] (7 PDB entries)
  8. 1275888Domain d3vlib1: 3vli B:18-423 [217920]
    automated match to d1ub2a1
    complexed with cyn, hem

Details for d3vlib1

PDB Entry: 3vli (more details), 1.7 Å

PDB Description: crystal structure analysis of the cyanide arg409leu variant katg from haloarcula marismortui
PDB Compounds: (B:) Catalase-peroxidase 2

SCOPe Domain Sequences for d3vlib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vlib1 a.93.1.0 (B:18-423) automated matches {Haloarcula marismortui [TaxId: 272569]}
krpksnqdwwpsklnleildqnardvgpveddfdyaeefqkldleavksdleelmtssqd
wwpadyghygplfirmawhsagtyrtadgrggaaggrqrfapinswpdnanldkarrlll
pikqkygqkiswadlmilagnvaiesmgfktfgyaggredafeedkavnwgpedefetqe
rfdepgeiqeglgasvmgliyvnpegpdgnpdpeasaknirqtfdrmamndketaaliag
ghtfgkvhgaddpeenlgpepeaapieqqglgwqnkngnskggemitsgiegpwtqspte
wdmgyinnlldyewepekgpggawqwapkseelknsvpdahdpdekqtpmmlttdialkr
dpdyrevmetfqenpmefgmnfakawyklthldmgpperflgpevp

SCOPe Domain Coordinates for d3vlib1:

Click to download the PDB-style file with coordinates for d3vlib1.
(The format of our PDB-style files is described here.)

Timeline for d3vlib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vlib2