SCOPe 2.03: Domain d3vlib1: 3vli B:18-423

Lineage for d3vlib1 (3vli B:18-423)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (8 species)
   not a true protein

7. Species Haloarcula marismortui [TaxId:272569] [226809] (7 PDB entries)

8. Domain d3vlib1: 3vli B:18-423 [217920]
   automated match to d1ub2a1
   complexed with cyn, hem

Details for d3vlib1

PDB Entry: 3vli, 1.7 Å

PDB Description: crystal structure analysis of the cyanide arg409leu variant katg from haloarcula marismortui

PDB Compounds: (B:) Catalase-peroxidase 2

SCOPe Domain Sequences for d3vlib1:

Sequence; same for both SEQRES and ATOM records:

>d3vlib1 a.93.1.0 (B:18-423) automated matches {Haloarcula marismortui [TaxId: 272569]}
krpksnqdwwpsklnleildqnardvgpveddfdyaeefqkldleavksdleelmtssqd
wwpadyghygplfirmawhsagtyrtadgrggaaggrqrfapinswpdnanldkarrlll
pikqkygqkiswadlmilagnvaiesmgfktfgyaggredafeedkavnwgpedefetqe
rfdepgeiqeglgasvmgliyvnpegpdgnpdpeasaknirqtfdrmamndketaaliag
ghtfgkvhgaddpeenlgpepeaapieqqglgwqnkngnskggemitsgiegpwtqspte
wdmgyinnlldyewepekgpggawqwapkseelknsvpdahdpdekqtpmmlttdialkr
dpdyrevmetfqenpmefgmnfakawyklthldmgpperflgpevp

Timeline for d3vlib1:

• d3vlib1 is new in SCOPe 2.03-stable
  
• d3vlib1 appears in SCOPe 2.04
  
• d3vlib1 appears in the current release, SCOPe 2.08