Lineage for d1f6aa2 (1f6a A:86-173)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764414Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1764578Protein IgE high affinity receptor alpha subunit [49200] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 1764579Species Human (Homo sapiens) [TaxId:9606] [49201] (7 PDB entries)
    Uniprot P12319 29-196
  8. 1764607Domain d1f6aa2: 1f6a A:86-173 [21792]
    Other proteins in same PDB: d1f6ab1, d1f6ab2, d1f6ad1, d1f6ad2
    complexed with cps, so4

Details for d1f6aa2

PDB Entry: 1f6a (more details), 3.5 Å

PDB Description: Structure of the human ige-fc bound to its high affinity receptor fc(epsilon)ri(alpha)
PDB Compounds: (A:) high affinity immunoglobulin epsilon receptor alpha-subunit

SCOPe Domain Sequences for d1f6aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6aa2 b.1.1.4 (A:86-173) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
dwlllqasaevvmegqplflrchgwrnwdvykviyykdgealkywyenhaisitnaaaed
sgtyyctgkvwqldyeseplnitvikap

SCOPe Domain Coordinates for d1f6aa2:

Click to download the PDB-style file with coordinates for d1f6aa2.
(The format of our PDB-style files is described here.)

Timeline for d1f6aa2: