Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein IgE high affinity receptor alpha subunit [49200] (1 species) possibly an intermediate structure between the I set and FnIII domains |
Species Human (Homo sapiens) [TaxId:9606] [49201] (7 PDB entries) Uniprot P12319 29-196 |
Domain d1f6aa1: 1f6a A:1-85 [21791] Other proteins in same PDB: d1f6ab1, d1f6ab2, d1f6ab3, d1f6ad1, d1f6ad2, d1f6ad3 complexed with cps, so4 |
PDB Entry: 1f6a (more details), 3.5 Å
SCOPe Domain Sequences for d1f6aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f6aa1 b.1.1.4 (A:1-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} vpqkpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakf edsgeykcqhqqvaesepvylevfs
Timeline for d1f6aa1: