Lineage for d1f2qa2 (1f2q A:86-174)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (21 proteins) 
Protein IgE high affinity receptor alpha subunit [49200] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49201] (2 PDB entries) 
Domain d1f2qa2: 1f2q A:86-174 [21790]
Details for d1f2qa2
PDB Entry: 1f2q (more details), 2.4 Å
PDB Description: crystal structure of the human high-affinity ige receptor
SCOP Domain Sequences for d1f2qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens)}
dwlllqasaevvmegqplflrchgwrnwdvykviyykdgealkywyenhnisitnatved
sgtyyctgkvwqldyeseplnitvikapr
SCOP Domain Coordinates for d1f2qa2:
Click to download the PDB-style file with coordinates for d1f2qa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f2qa2:
- d1f2qa2 appears in SCOP 1.57
- d1f2qa2 appears in the current release, SCOPe 2.08
View in 3D
