Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Lactate dehydrogenase [51859] (19 species) |
Species Lactobacillus casei [TaxId:1582] [51865] (7 PDB entries) |
Domain d3vkua1: 3vku A:7-150 [217881] Other proteins in same PDB: d3vkua2, d3vkub2, d3vkuc2, d3vkud2, d3vkue2, d3vkuf2 automated match to d1llca1 complexed with so4; mutant |
PDB Entry: 3vku (more details), 1.96 Å
SCOPe Domain Sequences for d3vkua1:
Sequence, based on SEQRES records: (download)
>d3vkua1 c.2.1.5 (A:7-150) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]} kdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpftspkki ysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflvaan pvdiltyatwklsgfpknrvvgsg
>d3vkua1 c.2.1.5 (A:7-150) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]} kdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpftspkki ysaeysdakdadlvvitagapilksivdpivdsgfngiflvaanpvdiltyatwklsgfp knrvvgsg
Timeline for d3vkua1: