Lineage for d3vk9d2 (3vk9 D:87-215)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714207Species Silkworm (Bombyx mori) [TaxId:7091] [226184] (9 PDB entries)
  8. 2714214Domain d3vk9d2: 3vk9 D:87-215 [217880]
    Other proteins in same PDB: d3vk9a1, d3vk9b1, d3vk9c1, d3vk9d1
    automated match to d1r5aa1
    complexed with gol

Details for d3vk9d2

PDB Entry: 3vk9 (more details), 2 Å

PDB Description: Crystal structure of delta-class glutathione transferase from silkmoth
PDB Compounds: (D:) Glutathione S-transferase delta

SCOPe Domain Sequences for d3vk9d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vk9d2 a.45.1.0 (D:87-215) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
edpkaralvdqrlyfdigtlyqrfsdyfypqvfagapadkaknekvqealqlldkflegq
kyvagpnltvadlsliasvssleasdidfkkyanvkrwyetvkstapgyqeanekgleaf
kglvnsmlk

SCOPe Domain Coordinates for d3vk9d2:

Click to download the PDB-style file with coordinates for d3vk9d2.
(The format of our PDB-style files is described here.)

Timeline for d3vk9d2: