Lineage for d1e4kc2 (1e4k C:87-172)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295367Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1295415Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 1295424Species Human (Homo sapiens), III [TaxId:9606] [49199] (5 PDB entries)
    Uniprot O75015 23-189
  8. 1295434Domain d1e4kc2: 1e4k C:87-172 [21788]
    Other proteins in same PDB: d1e4ka1, d1e4ka2, d1e4kb1, d1e4kb2

Details for d1e4kc2

PDB Entry: 1e4k (more details), 3.2 Å

PDB Description: crystal structure of soluble human igg1 fc fragment-fc-gamma receptor iii complex
PDB Compounds: (C:) low affinity immunoglobulin gamma fc receptor III

SCOPe Domain Sequences for d1e4kc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4kc2 b.1.1.4 (C:87-172) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
wlllqaprwvfkeedpihlrchswkntalhkvtylqngkdrkyfhhnsdfhipkatlkds
gsyfcrglvgsknvssetvnititqg

SCOPe Domain Coordinates for d1e4kc2:

Click to download the PDB-style file with coordinates for d1e4kc2.
(The format of our PDB-style files is described here.)

Timeline for d1e4kc2: