| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species) possibly an intermediate structure between the I set and FnIII domains |
| Species Human (Homo sapiens), III [TaxId:9606] [49199] (5 PDB entries) Uniprot O75015 23-189 |
| Domain d1e4kc1: 1e4k C:1-86 [21787] Other proteins in same PDB: d1e4ka1, d1e4ka2, d1e4kb1, d1e4kb2 |
PDB Entry: 1e4k (more details), 3.2 Å
SCOPe Domain Sequences for d1e4kc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4kc1 b.1.1.4 (C:1-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
dlpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaatv
ndsgeyrcqtnlstlsdpvqlevhig
Timeline for d1e4kc1:
View in 3DDomains from other chains: (mouse over for more information) d1e4ka1, d1e4ka2, d1e4kb1, d1e4kb2 |