SCOPe 2.06: Domain d1e4ja2: 1e4j A:87-172

Lineage for d1e4ja2 (1e4j A:87-172)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens), III [TaxId:9606] [49199] (5 PDB entries)
   Uniprot O75015 23-189

8. Domain d1e4ja2: 1e4j A:87-172 [21786]

Details for d1e4ja2

PDB Entry: 1e4j, 2.5 Å

PDB Description: crystal structure of the soluble human fc-gamma receptor iii

PDB Compounds: (A:) low affinity immunoglobulin gamma fc receptor III

SCOPe Domain Sequences for d1e4ja2:

Sequence; same for both SEQRES and ATOM records:

>d1e4ja2 b.1.1.4 (A:87-172) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
wlllqaprwvfkeedpihlrchswkntalhkvtylqngkdrkyfhhnsdfhipkatlkds
gsyfcrglvgsknvssetvnititqg

Timeline for d1e4ja2:

• d1e4ja2 first appeared (with stable ids) in SCOP 1.55
  
• d1e4ja2 appears in SCOPe 2.05
  
• d1e4ja2 appears in SCOPe 2.07
  
• d1e4ja2 appears in the current release, SCOPe 2.08