Lineage for d1e4ja1 (1e4j A:2-86)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54288Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
  7. 54297Species Human (Homo sapiens), III [TaxId:9606] [49199] (5 PDB entries)
  8. 54300Domain d1e4ja1: 1e4j A:2-86 [21785]

Details for d1e4ja1

PDB Entry: 1e4j (more details), 2.5 Å

PDB Description: crystal structure of the soluble human fc-gamma receptor iii

SCOP Domain Sequences for d1e4ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4ja1 b.1.1.4 (A:2-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III}
lpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaatvn
dsgeyrcqtnlstlsdpvqlevhig

SCOP Domain Coordinates for d1e4ja1:

Click to download the PDB-style file with coordinates for d1e4ja1.
(The format of our PDB-style files is described here.)

Timeline for d1e4ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e4ja2