![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
![]() | Protein Class sigma GST [81362] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89705] (7 PDB entries) Uniprot O60760 synonym: hematopoietic prostaglandin D synthase |
![]() | Domain d3vi7d1: 3vi7 D:602-675 [217842] Other proteins in same PDB: d3vi7a2, d3vi7b2, d3vi7c2, d3vi7d2 automated match to d1iyha2 complexed with ca, cbd, gsh |
PDB Entry: 3vi7 (more details), 2 Å
SCOPe Domain Sequences for d3vi7d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vi7d1 c.47.1.5 (D:602-675) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl hqslaiaryltknt
Timeline for d3vi7d1: