SCOP 1.57: Domain d1fnla2: 1fnl A:87-175

Lineage for d1fnla2 (1fnl A:87-175)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (22 proteins)

6. Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)

7. Species Human (Homo sapiens), III [TaxId:9606] [49199] (5 PDB entries)

8. Domain d1fnla2: 1fnl A:87-175 [21784]

Details for d1fnla2

PDB Entry: 1fnl, 1.8 Å

PDB Description: crystal structure of the extracellular domain of a human fcgriii

SCOP Domain Sequences for d1fnla2:

Sequence; same for both SEQRES and ATOM records:

>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III}
higwlllqaprwvfkeedpihlrchswkntalhkvtylqngkdrkyfhhnsdfhipkatl
kdsgsyfcrglvgsknvssetvnititqa

Timeline for d1fnla2:

• d1fnla2 first appeared (with stable ids) in SCOP 1.55
  
• d1fnla2 appears in SCOP 1.59
  
• d1fnla2 appears in the current release, SCOPe 2.08