SCOPe 2.03: Domain d3vi7a2: 3vi7 A:76-199

Lineage for d3vi7a2 (3vi7 A:76-199)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class sigma GST [81351] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89061] (13 PDB entries)
   Uniprot O60760; synonym: hematopoietic prostaglandin D synthase

8. Domain d3vi7a2: 3vi7 A:76-199 [217837]
   Other proteins in same PDB: d3vi7a1, d3vi7b1, d3vi7c1, d3vi7d1
   automated match to d1iyha1
   complexed with ca, cbd, gsh

Details for d3vi7a2

PDB Entry: 3vi7, 2 Å

PDB Description: Human hematopoietic prostaglandin D synthase inhibitor complex structures

PDB Compounds: (A:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d3vi7a2:

Sequence; same for both SEQRES and ATOM records:

>d3vi7a2 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

Timeline for d3vi7a2:

• d3vi7a2 is new in SCOPe 2.03-stable
  
• d3vi7a2 appears in SCOPe 2.04
  
• d3vi7a2 appears in the current release, SCOPe 2.08