SCOP 1.75: Domain d1fnla1: 1fnl A:3-86

Lineage for d1fnla1 (1fnl A:3-86)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (38 proteins)

6. Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens), III [TaxId:9606] [49199] (5 PDB entries)
   Uniprot O75015 23-189

8. Domain d1fnla1: 1fnl A:3-86 [21783]

Details for d1fnla1

PDB Entry: 1fnl, 1.8 Å

PDB Description: crystal structure of the extracellular domain of a human fcgriii

PDB Compounds: (A:) low affinity immunoglobulin gamma fc region receptor III-b

SCOP Domain Sequences for d1fnla1:

Sequence; same for both SEQRES and ATOM records:

>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
edlpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaat
vndsgeyrcqtnlstlsdpvqlev

Timeline for d1fnla1:

• d1fnla1 first appeared (with stable ids) in SCOP 1.55
  
• d1fnla1 appears in SCOP 1.73
  
• d1fnla1 appears in SCOPe 2.01
  
• d1fnla1 appears in the current release, SCOPe 2.08