SCOPe 2.05: Domain d3vi5a2: 3vi5 A:76-199

Lineage for d3vi5a2 (3vi5 A:76-199)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class sigma GST [81351] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89061] (7 PDB entries)
   Uniprot O60760; synonym: hematopoietic prostaglandin D synthase

8. Domain d3vi5a2: 3vi5 A:76-199 [217829]
   Other proteins in same PDB: d3vi5a1, d3vi5b1, d3vi5c1, d3vi5d1
   automated match to d1iyha1
   complexed with ca, gol, gsh, m4m

Details for d3vi5a2

PDB Entry: 3vi5, 2 Å

PDB Description: Human hematopoietic prostaglandin D synthase inhibitor complex structures

PDB Compounds: (A:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d3vi5a2:

Sequence; same for both SEQRES and ATOM records:

>d3vi5a2 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

Timeline for d3vi5a2:

• d3vi5a2 first appeared in SCOPe 2.03
  
• d3vi5a2 appears in SCOPe 2.04
  
• d3vi5a2 appears in SCOPe 2.06
  
• d3vi5a2 appears in the current release, SCOPe 2.08