Lineage for d3vi3l1 (3vi3 L:1-112)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1767236Domain d3vi3l1: 3vi3 L:1-112 [217826]
    Other proteins in same PDB: d3vi3a1, d3vi3a2, d3vi3c1, d3vi3c2, d3vi3e2, d3vi3l2
    automated match to d1dqdl1
    complexed with ca, mg, nag

Details for d3vi3l1

PDB Entry: 3vi3 (more details), 2.9 Å

PDB Description: crystal structure of alpha5beta1 integrin headpiece (ligand-free form)
PDB Compounds: (L:) SG/19 Fab fragment (Light chain)

SCOPe Domain Sequences for d3vi3l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vi3l1 b.1.1.0 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqatpsipvtpgesvsiscrsnksllhsngntylywflqrpgqsprllifrmsnla
sgvpdrfsgsgsgtaftlrisrveaadvgiyfclqhleypftfgagtklelk

SCOPe Domain Coordinates for d3vi3l1:

Click to download the PDB-style file with coordinates for d3vi3l1.
(The format of our PDB-style files is described here.)

Timeline for d3vi3l1: