SCOPe 2.07: Domain d3vi3e2: 3vi3 E:113-219

Lineage for d3vi3e2 (3vi3 E:113-219)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
Domain d3vi3e2: 3vi3 E:113-219 [217825]
Other proteins in same PDB: d3vi3a1, d3vi3a2, d3vi3c1, d3vi3c2, d3vi3e1, d3vi3l1
automated match to d1dqdl2
complexed with bma, ca, man, mg, nag

Details for d3vi3e2

PDB Entry: 3vi3 (more details), 2.9 Å

PDB Description: crystal structure of alpha5beta1 integrin headpiece (ligand-free form)

PDB Compounds: (E:) SG/19 Fab fragment (Light chain)

SCOPe Domain Sequences for d3vi3e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vi3e2 b.1.1.2 (E:113-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d3vi3e2:

Click to download the PDB-style file with coordinates for d3vi3e2.
(The format of our PDB-style files is described here.)

Timeline for d3vi3e2: