Lineage for d3vi3e1 (3vi3 E:1-112)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1520955Domain d3vi3e1: 3vi3 E:1-112 [217824]
    Other proteins in same PDB: d3vi3a1, d3vi3a2, d3vi3c1, d3vi3c2, d3vi3e2, d3vi3l2
    automated match to d1dqdl1
    complexed with ca, mg, nag

Details for d3vi3e1

PDB Entry: 3vi3 (more details), 2.9 Å

PDB Description: crystal structure of alpha5beta1 integrin headpiece (ligand-free form)
PDB Compounds: (E:) SG/19 Fab fragment (Light chain)

SCOPe Domain Sequences for d3vi3e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vi3e1 b.1.1.0 (E:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqatpsipvtpgesvsiscrsnksllhsngntylywflqrpgqsprllifrmsnla
sgvpdrfsgsgsgtaftlrisrveaadvgiyfclqhleypftfgagtklelk

SCOPe Domain Coordinates for d3vi3e1:

Click to download the PDB-style file with coordinates for d3vi3e1.
(The format of our PDB-style files is described here.)

Timeline for d3vi3e1: